- Recombinant Alcelaphine herpesvirus 1 Putative apoptosis regulator A9 (A9)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1078385
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 19,555 Da
- E Coli or Yeast
- 1-168
- Putative apoptosis regulator A9 (A9)
Sequence
MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTPRPHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLLYFRTTQTK